PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10021115m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 328aa    MW: 35952 Da    PI: 5.4756
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10021115mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.86.4e-15232287358
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                      ++kr+rr+ +NRe+ArrsR+RK+a + eLe+ + +L ae ++L k l   ++++++
  Ciclev10021115m 232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDE 287
                      68******************************************999888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.1E-11230284No hitNo description
SMARTSM003383.4E-16230294IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909232287IPR004827Basic-leucine zipper domain
PfamPF001707.9E-12233286IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.34E-10234283No hitNo description
PROSITE patternPS000360237252IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MNSVFSADDF SDSFLSSPSP PPASFHALPM NRSQSEWELE KFLQEVTVSP RAISSSSASD  60
NSVPAVIGPS VMSKSRAYEI GDDDVVEIKK SHRDQSLDPP VIPSSTAPVD SDQYRAYLKT  120
KLDLACAAVA LRTAPVKPED KSSLIENQTQ AAKPSELGSQ AMATVNVSTA HDALGTHPKA  180
DFRPLGSADL PAVQARPAAQ VRQSTSGSSR EDSDDDELEG DTETIEGLDS VDDKRARRML  240
SNRESARRSR RRKQAHLNEL ETQAGQLRAE HSSLLKGLTD VNQKYDESAV NNRILKADIE  300
TLRAKVTYYF IRIIQLSIFY IMWLRSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246253RRSRRRKQ
2248253SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.50900.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006479611.10.0PREDICTED: light-inducible protein CPRF2 isoform X3
TrEMBLA0A067FQY40.0A0A067FQY4_CITSI; Uncharacterized protein
STRINGVIT_14s0030g02200.t012e-66(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.12e-36basic leucine zipper 25